General Information

  • ID:  hor004149
  • Uniprot ID:  P49926(154-194)
  • Protein name:  Corticoliberin
  • Gene name:  CRH
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  Produced by the hypothalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0017045 corticotropin-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0032811 negative regulation of epinephrine secretion; GO:0051464 positive regulation of cortisol secretion; GO:0070093 negative regulation of glucagon secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
  • Length:  41(154-194)
  • Propeptide:  MRLPLLLSAGVLLVVSLPCPPCRALLSRGPIPGARQAAQHPQPLDFFQLPPQPQQPQQPQARPVLYRMGEEYFLRLGNLNKSPAAPLLPASSPVAGGSGSRLSPDEAAANFFRALLQQLPLPRRQLDSPAGPAERGEENALGSRQETPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
  • Signal peptide:  MRLPLLLSAGVLLVVSLPCPPCRA
  • Modification:  T41 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 30.5???.3 minutes; /1830 seconds ( PubMed ID: 1319455 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P49926-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004149_AF2.pdbhor004149_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 547216 Formula: C208H343N59O64S2
Absent amino acids: CGWY Common amino acids: L
pI: 4.86 Basic residues: 6
Polar residues: 5 Hydrophobic residues: 16
Hydrophobicity: -25.61 Boman Index: -7708
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 111.95
Instability Index: 5246.83 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7969821##1319455
  • Title:  Predicted Primary and Antigenic Structure of Canine Corticotropin Releasing Hormone